Anti IL32 pAb (ATL-HPA029397 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA029397-25

Protein Description: interleukin 32
Gene Name: IL32
Alternative Gene Name: NK4, TAIF, TAIFb, TAIFd
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024240: 27%, ENSRNOG00000024482: 30%
Entrez Gene ID: 9235
Uniprot ID: P24001
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCR
• Gene Sequence: FPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCR
• Gene ID - Mouse: ENSMUSG00000024240
• Gene ID - Rat: ENSRNOG00000024482
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.