Anti IL1RAPL2 pAb (ATL-HPA036128 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA036128-25

• 
• 

Protein Description: interleukin 1 receptor accessory protein-like 2
Gene Name: IL1RAPL2
Alternative Gene Name: IL-1R9, IL1R9, IL1RAPL-2, TIGIRR-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059203: 100%, ENSRNOG00000062221: 100%
Entrez Gene ID: 26280
Uniprot ID: Q9NP60
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TTELKVTALLTDKPPKPLFPMENQPSVIDVQLGKPLNIPCKAFFGFSGESGPMIYWMKGEKFIEELAGHIREGEIRLL
• Gene Sequence: TTELKVTALLTDKPPKPLFPMENQPSVIDVQLGKPLNIPCKAFFGFSGESGPMIYWMKGEKFIEELAGHIREGEIRLL
• Gene ID - Mouse: ENSMUSG00000059203
• Gene ID - Rat: ENSRNOG00000062221
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.