Anti IL18BP pAb (ATL-HPA041061 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041061-25

Protein Description: interleukin 18 binding protein
Gene Name: IL18BP
Alternative Gene Name: IL18BPa
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070427: 57%, ENSRNOG00000020150: 56%
Entrez Gene ID: 10068
Uniprot ID: O95998
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG
• Gene Sequence: RLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG
• Gene ID - Mouse: ENSMUSG00000070427
• Gene ID - Rat: ENSRNOG00000020150
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.