Anti IKZF3 pAb (ATL-HPA073266 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA073266-25

Protein Description: IKAROS family zinc finger 3
Gene Name: IKZF3
Alternative Gene Name: Aiolos, ZNFN1A3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018168: 83%, ENSRNOG00000007200: 85%
Entrez Gene ID: 22806
Uniprot ID: Q9UKT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TPPAPTSEMVPVISSMYPIALTRAEMSNGAPQELEKKSIHLPEKSVPSERGLSPNNSGHD
• Gene Sequence: TPPAPTSEMVPVISSMYPIALTRAEMSNGAPQELEKKSIHLPEKSVPSERGLSPNNSGHD
• Gene ID - Mouse: ENSMUSG00000018168
• Gene ID - Rat: ENSRNOG00000007200
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.