Anti IKZF1 pAb (ATL-HPA035221 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035221-25

Protein Description: IKAROS family zinc finger 1 (Ikaros)
Gene Name: IKZF1
Alternative Gene Name: hIk-1, Hs.54452, IKAROS, LyF-1, PPP1R92, ZNFN1A1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018654: 87%, ENSRNOG00000004444: 87%
Entrez Gene ID: 10320
Uniprot ID: Q13422
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SNNEEQRSGLIYLTNHIAPHARNGLSLKEEHRAYDLLRAASENSQDALRVVSTSGEQMKVYKC
• Gene Sequence: SNNEEQRSGLIYLTNHIAPHARNGLSLKEEHRAYDLLRAASENSQDALRVVSTSGEQMKVYKC
• Gene ID - Mouse: ENSMUSG00000018654
• Gene ID - Rat: ENSRNOG00000004444
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.