Anti IGSF1 pAb (ATL-HPA035582 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035582-25

Protein Description: immunoglobulin superfamily, member 1
Gene Name: IGSF1
Alternative Gene Name: IGCD1, IGDC1, INHBP, KIAA0364, MGC75490, PGSF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031111: 99%, ENSRNOG00000007600: 97%
Entrez Gene ID: 3547
Uniprot ID: Q8N6C5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IVMPTPKPELWAETNFPLAPWKNLTLWCRSPSGSTKEFVLLKDGTGWIATRPASEQVRAAFPLGALTQSHTGSYHCHSWEEMAVSEPSE
• Gene Sequence: IVMPTPKPELWAETNFPLAPWKNLTLWCRSPSGSTKEFVLLKDGTGWIATRPASEQVRAAFPLGALTQSHTGSYHCHSWEEMAVSEPSE
• Gene ID - Mouse: ENSMUSG00000031111
• Gene ID - Rat: ENSRNOG00000007600
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.