Anti IGFN1 pAb (ATL-HPA050415 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA050415-25

Protein Description: immunoglobulin-like and fibronectin type III domain containing 1
Gene Name: IGFN1
Alternative Gene Name: DKFZp434B1231, EEF1A2BP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051985: 76%, ENSRNOG00000026087: 76%
Entrez Gene ID: 91156
Uniprot ID: Q86VF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIYTNRFTLLGILPGHEYHFRVVA
• Gene Sequence: AHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIYTNRFTLLGILPGHEYHFRVVA
• Gene ID - Mouse: ENSMUSG00000051985
• Gene ID - Rat: ENSRNOG00000026087
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.