Anti IGFALS pAb (ATL-HPA040692 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA040692-25

Protein Description: insulin-like growth factor binding protein, acid labile subunit
Gene Name: IGFALS
Alternative Gene Name: ALS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046070: 76%, ENSRNOG00000015061: 77%
Entrez Gene ID: 3483
Uniprot ID: P35858
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DCGCPLKALRDFALQNPSAVPRFVQAICEGDDCQPPAYTYNNITCASPPEVVGLDLRDLSEAHFAP
• Gene Sequence: DCGCPLKALRDFALQNPSAVPRFVQAICEGDDCQPPAYTYNNITCASPPEVVGLDLRDLSEAHFAP
• Gene ID - Mouse: ENSMUSG00000046070
• Gene ID - Rat: ENSRNOG00000015061
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.