Anti IFT57 pAb (ATL-HPA035514)

Atlas Antibodies

Catalog No.: ATL-HPA035514-100

Protein Description: intraflagellar transport 57
Gene Name: IFT57
Alternative Gene Name: ESRRBL1, FLJ10147, HIPPI, MHS4R2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032965: 93%, ENSRNOG00000001958: 94%
Entrez Gene ID: 55081
Uniprot ID: Q9NWB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RSFGRTADFPPSKLKSGYGEHVCYVLDCFAEEALKYIGFTWKRPIYPVEELEEESVAEDDAELTLNKVDEEFVEEETDNEENFIDLN
• Gene Sequence: RSFGRTADFPPSKLKSGYGEHVCYVLDCFAEEALKYIGFTWKRPIYPVEELEEESVAEDDAELTLNKVDEEFVEEETDNEENFIDLN
• Gene ID - Mouse: ENSMUSG00000032965
• Gene ID - Rat: ENSRNOG00000001958
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.