Anti IFT46 pAb (ATL-HPA057550)

Atlas Antibodies

Catalog No.: ATL-HPA057550-25

Protein Description: intraflagellar transport 46
Gene Name: IFT46
Alternative Gene Name: C11orf2, C11orf60, CFAP32, FLJ21827
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002031: 100%, ENSRNOG00000013919: 100%
Entrez Gene ID: 56912
Uniprot ID: Q9NQC8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LDEPSTKQSDPTVLSLWLTENSKQHNITQHMKVKSLEDAEKNPKAIDTWIESISELHRSKPPATVHYTRPMPDIDTLMQEWSPEF
• Gene Sequence: LDEPSTKQSDPTVLSLWLTENSKQHNITQHMKVKSLEDAEKNPKAIDTWIESISELHRSKPPATVHYTRPMPDIDTLMQEWSPEF
• Gene ID - Mouse: ENSMUSG00000002031
• Gene ID - Rat: ENSRNOG00000013919
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.