Anti IFT46 pAb (ATL-HPA037909)

Atlas Antibodies

Catalog No.: ATL-HPA037909-25

Protein Description: intraflagellar transport 46
Gene Name: IFT46
Alternative Gene Name: C11orf2, C11orf60, CFAP32, FLJ21827
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002031: 97%, ENSRNOG00000013919: 97%
Entrez Gene ID: 56912
Uniprot ID: Q9NQC8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ETDSDSDDDDEEHGAPLEGAYDPADYEHLPVSAEIKELFQYISRYTPQLIDLDHKLKPFIPDFIPAVGDIDAFLKVPRPDGKPDNLGLLV
• Gene Sequence: ETDSDSDDDDEEHGAPLEGAYDPADYEHLPVSAEIKELFQYISRYTPQLIDLDHKLKPFIPDFIPAVGDIDAFLKVPRPDGKPDNLGLLV
• Gene ID - Mouse: ENSMUSG00000002031
• Gene ID - Rat: ENSRNOG00000013919
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IFT46 pAb (ATL-HPA037909) – 2 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Xu, Yanan; Cao, Jingli; Huang, Shan; Feng, Di; Zhang, Wei; Zhu, Xueliang; Yan, Xiumin. Characterization of tetratricopeptide repeat-containing proteins critical for cilia formation and function. Plos One. 10(4):e0124378.