Anti IFI16 pAb (ATL-HPA002134 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA002134-25

Protein Description: interferon, gamma-inducible protein 16
Gene Name: IFI16
Alternative Gene Name: IFNGIP1, PYHIN2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039997: 53%, ENSRNOG00000003480: 39%
Entrez Gene ID: 3428
Uniprot ID: Q16666
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KEKFTPKKIIAIANYVCRNGFLEVYPFTLVADVNADRNMEIPKGLIRSASVTPKINQLCSQTKGSFVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIK
• Gene Sequence: KEKFTPKKIIAIANYVCRNGFLEVYPFTLVADVNADRNMEIPKGLIRSASVTPKINQLCSQTKGSFVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIK
• Gene ID - Mouse: ENSMUSG00000039997
• Gene ID - Rat: ENSRNOG00000003480
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IFI16 pAb (ATL-HPA002134 w/enhanced validation) – 4 Found

Iqbal, Jawed; Ansari, Mairaj Ahmed; Kumar, Binod; Dutta, Dipanjan; Roy, Arunava; Chikoti, Leela; Pisano, Gina; Dutta, Sujoy; Vahedi, Shahrooz; Veettil, Mohanan Valiya; Chandran, Bala. Histone H2B-IFI16 Recognition of Nuclear Herpesviral Genome Induces Cytoplasmic Interferon-β Responses. Plos Pathogens. 2016;12(10):e1005967. 

Farshchian, Mehdi; Nissinen, Liisa; Siljamäki, Elina; Riihilä, Pilvi; Piipponen, Minna; Kivisaari, Atte; Kallajoki, Markku; Grénman, Reidar; Peltonen, Juha; Peltonen, Sirkku; Quint, Koen D; Bavinck, Jan Nico Bouwes; Kähäri, Veli-Matti. Tumor cell-specific AIM2 regulates growth and invasion of cutaneous squamous cell carcinoma. Oncotarget. 2017;8(28):45825-45836. 

Hyun, Jinhee; McMahon, Robert S; Lang, Anna L; Edwards, Jasmine S; Badilla, Alejandro Dmitar; Greene, Morgan E; Stone, Geoffrey W; Pallikkuth, Suresh; Stevenson, Mario; Dykxhoorn, Derek M; Kottilil, Shyam; Pahwa, Savita; Thomas, Emmanuel. HIV and HCV augments inflammatory responses through increased TREM-1 expression and signaling in Kupffer and Myeloid cells. Plos Pathogens. 2019;15(7):e1007883. 

Krump, Nathan A; Wang, Ranran; Liu, Wei; Yang, June F; Ma, Tongcui; You, Jianxin. Merkel Cell Polyomavirus Infection Induces an Antiviral Innate Immune Response in Human Dermal Fibroblasts. Journal Of Virology. 2021;95(13):e0221120.