Anti ICMT pAb (ATL-HPA032025 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA032025-25

Protein Description: isoprenylcysteine carboxyl methyltransferase
Gene Name: ICMT
Alternative Gene Name: HSTE14, PCCMT, PPMT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039662: 98%, ENSRNOG00000010953: 98%
Entrez Gene ID: 23463
Uniprot ID: O60725
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TVWRFFRDRTEEEEISLIHFFGEEYLEYKKRVPTGLPFIK
• Gene Sequence: TVWRFFRDRTEEEEISLIHFFGEEYLEYKKRVPTGLPFIK
• Gene ID - Mouse: ENSMUSG00000039662
• Gene ID - Rat: ENSRNOG00000010953
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.