Anti HSPG2 pAb (ATL-HPA072690)

Atlas Antibodies

Catalog No.: ATL-HPA072690-25

Protein Description: heparan sulfate proteoglycan 2
Gene Name: HSPG2
Alternative Gene Name: perlecan, PRCAN, SJS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028763: 88%, ENSRNOG00000021437: 88%
Entrez Gene ID: 3339
Uniprot ID: P98160
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGMVFGIPDGVLELVPQRGPCPDGHFYLEHSAACLPCFCFGITSVCQSTRRFRDQIRLRFDQPDDFKGVNVTMPAQPGTPPLSSTQLQIDPSL
• Gene Sequence: RGMVFGIPDGVLELVPQRGPCPDGHFYLEHSAACLPCFCFGITSVCQSTRRFRDQIRLRFDQPDDFKGVNVTMPAQPGTPPLSSTQLQIDPSL
• Gene ID - Mouse: ENSMUSG00000028763
• Gene ID - Rat: ENSRNOG00000021437
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.