Anti HSPE1 pAb (ATL-HPA038755)

Atlas Antibodies

Catalog No.: ATL-HPA038755-25

Protein Description: heat shock 10kDa protein 1
Gene Name: HSPE1
Alternative Gene Name: CPN10, GROES
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073676: 95%, ENSRNOG00000051624: 98%
Entrez Gene ID: 3336
Uniprot ID: P61604
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSV
• Gene Sequence: GQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSV
• Gene ID - Mouse: ENSMUSG00000073676
• Gene ID - Rat: ENSRNOG00000051624
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.