Anti HSPA5 pAb (ATL-HPA038846 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038846-100

Protein Description: heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa)
Gene Name: HSPA5
Alternative Gene Name: BiP, GRP78
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026864: 99%, ENSRNOG00000018294: 99%
Entrez Gene ID: 3309
Uniprot ID: P11021
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAK
• Gene Sequence: GEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAK
• Gene ID - Mouse: ENSMUSG00000026864
• Gene ID - Rat: ENSRNOG00000018294
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.