Anti HSPA1L pAb (ATL-HPA043285 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043285-25

Protein Description: heat shock 70kDa protein 1-like
Gene Name: HSPA1L
Alternative Gene Name: HSP70-HOM, hum70t
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007033: 81%, ENSRNOG00000047966: 81%
Entrez Gene ID: 3305
Uniprot ID: P34931
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLYQGGCTGPACGTGYVPGRPATGPTIEEVD
• Gene Sequence: KLYQGGCTGPACGTGYVPGRPATGPTIEEVD
• Gene ID - Mouse: ENSMUSG00000007033
• Gene ID - Rat: ENSRNOG00000047966
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.