Anti HSF2BP pAb (ATL-HPA075775 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA075775-25

• 

Protein Description: heat shock transcription factor 2 binding protein
Gene Name: HSF2BP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002076: 90%, ENSRNOG00000001193: 92%
Entrez Gene ID: 11077
Uniprot ID: O75031
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DNIREKKEKLALRQQLNEAKQQLLQQAEYCTEMGAAACTLLWGVSSSEEVVKAILGGDKALKFFSITGQTM
• Gene Sequence: DNIREKKEKLALRQQLNEAKQQLLQQAEYCTEMGAAACTLLWGVSSSEEVVKAILGGDKALKFFSITGQTM
• Gene ID - Mouse: ENSMUSG00000002076
• Gene ID - Rat: ENSRNOG00000001193
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.