Anti HSF2 pAb (ATL-HPA031455)

Atlas Antibodies

Catalog No.: ATL-HPA031455-25

Protein Description: heat shock transcription factor 2
Gene Name: HSF2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019878: 91%, ENSRNOG00000000808: 92%
Entrez Gene ID: 3298
Uniprot ID: Q03933
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGKVELLDYLDSIDCSLEDFQAMLSGRQFSIDPDLLVDSENKGLETTKNNVVQPVSEEGRKSKSKPDKQLIQYTAFPLLAFLDGNPASSVEQASTTASSEVLSSVD
• Gene Sequence: LGKVELLDYLDSIDCSLEDFQAMLSGRQFSIDPDLLVDSENKGLETTKNNVVQPVSEEGRKSKSKPDKQLIQYTAFPLLAFLDGNPASSVEQASTTASSEVLSSVD
• Gene ID - Mouse: ENSMUSG00000019878
• Gene ID - Rat: ENSRNOG00000000808
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HSF2 pAb (ATL-HPA031455) – 1 Found

Pesonen, Linda; Svartsjö, Sally; Bäck, Viktor; de Thonel, Aurélie; Mezger, Valérie; Sabéran-Djoneidi, Délara; Roos-Mattjus, Pia. Gambogic acid and gambogenic acid induce a thiol-dependent heat shock response and disrupt the interaction between HSP90 and HSF1 or HSF2. Cell Stress & Chaperones. 2021;26(5):819-833.