Anti HSD3B1 pAb (ATL-HPA043261)

Atlas Antibodies

Catalog No.: ATL-HPA043261-25

Protein Description: hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1
Gene Name: HSD3B1
Alternative Gene Name: HSD3B, HSDB3, SDR11E1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038092: 83%, ENSRNOG00000042884: 86%
Entrez Gene ID: 3283
Uniprot ID: P14060
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGQFYYISDDTPHQSYDNLNYTLSKEFGLRLDSRWS
• Gene Sequence: RGQFYYISDDTPHQSYDNLNYTLSKEFGLRLDSRWS
• Gene ID - Mouse: ENSMUSG00000038092
• Gene ID - Rat: ENSRNOG00000042884
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.