Anti HS3ST5 pAb (ATL-HPA064677 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA064677-25

Protein Description: heparan sulfate (glucosamine) 3-O-sulfotransferase 5
Gene Name: HS3ST5
Alternative Gene Name: 3-OST-5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044499: 99%, ENSRNOG00000000605: 99%
Entrez Gene ID: 222537
Uniprot ID: Q8IZT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DYTQVLEGKERKNKTYYKFEKLAIDPNTCEVNTKYKAVRTSIYTKHLERWLKYFPIEQFHVVDGDRLITEPLP
• Gene Sequence: DYTQVLEGKERKNKTYYKFEKLAIDPNTCEVNTKYKAVRTSIYTKHLERWLKYFPIEQFHVVDGDRLITEPLP
• Gene ID - Mouse: ENSMUSG00000044499
• Gene ID - Rat: ENSRNOG00000000605
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.