Anti HS3ST3B1 pAb (ATL-HPA064126)

Atlas Antibodies

Catalog No.: ATL-HPA064126-25

Protein Description: heparan sulfate (glucosamine) 3-O-sulfotransferase 3B1
Gene Name: HS3ST3B1
Alternative Gene Name: 30ST3B1, 3OST3B1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070407: 73%, ENSRNOG00000003384: 72%
Entrez Gene ID: 9953
Uniprot ID: Q9Y662
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLLGSGSRAAHDPPALATAPDGTPPRLPFRAPPATPLASGKEMAEGAASPEEQSPEVPDSPSPISSFFSGSGSK
• Gene Sequence: LLLGSGSRAAHDPPALATAPDGTPPRLPFRAPPATPLASGKEMAEGAASPEEQSPEVPDSPSPISSFFSGSGSK
• Gene ID - Mouse: ENSMUSG00000070407
• Gene ID - Rat: ENSRNOG00000003384
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.