Anti HNRNPUL1 pAb (ATL-HPA046290 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA046290-25

Protein Description: heterogeneous nuclear ribonucleoprotein U-like 1
Gene Name: HNRNPUL1
Alternative Gene Name: E1B-AP5, E1BAP5, FLJ12944, HNRPUL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040725: 85%, ENSRNOG00000020683: 85%
Entrez Gene ID: 11100
Uniprot ID: Q9BUJ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NESGYERRPLEMEQQQAYRPEMKTEMKQGAPTSFLPPEASQLKPDRQQFQSRKRPYEENRGRGYFEHREDRRGRSPQPPAEEDE
• Gene Sequence: NESGYERRPLEMEQQQAYRPEMKTEMKQGAPTSFLPPEASQLKPDRQQFQSRKRPYEENRGRGYFEHREDRRGRSPQPPAEEDE
• Gene ID - Mouse: ENSMUSG00000040725
• Gene ID - Rat: ENSRNOG00000020683
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HNRNPUL1 pAb (ATL-HPA046290 w/enhanced validation) – 1 Found

Alm, Tove; Lundberg, Emma; Uhlén, Mathias. Introducing the Affinity Binder Knockdown Initiative⿿A public⿿private partnership for validation of affinity reagents. Eupa Open Proteomics. 2016;10( 29900101):56-58.