Anti HMX2 pAb (ATL-HPA043379 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043379-25

Protein Description: H6 family homeobox 2
Gene Name: HMX2
Alternative Gene Name: NKX5-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050100: 97%, ENSRNOG00000020638: 97%
Entrez Gene ID: 3167
Uniprot ID: A2RU54
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELEAANMAHASAQTLVSMPLVFRDSSLLRVPVPRSLAFPAPLYYPGSNLSALPLYNLYNKLDY
• Gene Sequence: ELEAANMAHASAQTLVSMPLVFRDSSLLRVPVPRSLAFPAPLYYPGSNLSALPLYNLYNKLDY
• Gene ID - Mouse: ENSMUSG00000050100
• Gene ID - Rat: ENSRNOG00000020638
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.