Anti HMGB3 pAb (ATL-HPA062583 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA062583-25

Protein Description: high mobility group box 3
Gene Name: HMGB3
Alternative Gene Name: HMG2A, HMG4, MGC90319
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015217: 97%, ENSRNOG00000050910: 97%
Entrez Gene ID: 3149
Uniprot ID: O15347
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EKYEKDVADYKSKGKFDGAKGPAKVARKKVEEEDEE
• Gene Sequence: EKYEKDVADYKSKGKFDGAKGPAKVARKKVEEEDEE
• Gene ID - Mouse: ENSMUSG00000015217
• Gene ID - Rat: ENSRNOG00000050910
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.