Anti HK1 pAb (ATL-HPA007044 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA007044-100

Protein Description: hexokinase 1
Gene Name: HK1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037012: 97%, ENSRNOG00000046891: 94%
Entrez Gene ID: 3098
Uniprot ID: P19367
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLN
• Gene Sequence: LPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLN
• Gene ID - Mouse: ENSMUSG00000037012
• Gene ID - Rat: ENSRNOG00000046891
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HK1 pAb (ATL-HPA007044 w/enhanced validation) – 2 Found

Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51. 

Nussbaumer, Markus; Asara, John M; Teplytska, Larysa; Murphy, Michael P; Logan, Angela; Turck, Christoph W; Filiou, Michaela D. Selective Mitochondrial Targeting Exerts Anxiolytic Effects In Vivo. Neuropsychopharmacology : Official Publication Of The American College Of Neuropsychopharmacology. 2016;41(7):1751-8.