Anti HIKESHI pAb (ATL-HPA035064)

Atlas Antibodies

Catalog No.: ATL-HPA035064-25

Protein Description: Hikeshi, heat shock protein nuclear import factor
Gene Name: HIKESHI
Alternative Gene Name: C11orf73, HSPC138, HSPC179, OPI10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062797: 95%, ENSRNOG00000017383: 95%
Entrez Gene ID: 51501
Uniprot ID: Q53FT3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VELLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK
• Gene Sequence: VELLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK
• Gene ID - Mouse: ENSMUSG00000062797
• Gene ID - Rat: ENSRNOG00000017383
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.