Anti HIF3A pAb (ATL-HPA041141)

Atlas Antibodies

SKU: ATL-HPA041141-25

• 

Protein Description: hypoxia inducible factor 3, alpha subunit
Gene Name: HIF3A
Alternative Gene Name: bHLHe17, IPAS, MOP7, PASD7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004328: 72%, ENSRNOG00000017198: 70%
Entrez Gene ID: 64344
Uniprot ID: Q9Y2N7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPDLRRLLGPILDGASVAATPSTPLATRHPQSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQDADALD
• Gene Sequence: SPDLRRLLGPILDGASVAATPSTPLATRHPQSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQDADALD
• Gene ID - Mouse: ENSMUSG00000004328
• Gene ID - Rat: ENSRNOG00000017198
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HIF3A pAb (ATL-HPA041141) – 1 Found

Tojo, Yutaka; Sekine, Hiroki; Hirano, Ikuo; Pan, Xiaoqing; Souma, Tomokazu; Tsujita, Tadayuki; Kawaguchi, Shin-ichi; Takeda, Norihiko; Takeda, Kotaro; Fong, Guo-Hua; Dan, Takashi; Ichinose, Masakazu; Miyata, Toshio; Yamamoto, Masayuki; Suzuki, Norio. Hypoxia Signaling Cascade for Erythropoietin Production in Hepatocytes. Molecular And Cellular Biology. 2015;35(15):2658-72.