Anti HGF pAb (ATL-HPA044088)

Atlas Antibodies

SKU: ATL-HPA044088-25

• 

Protein Description: hepatocyte growth factor (hepapoietin A; scatter factor)
Gene Name: HGF
Alternative Gene Name: DFNB39, F-TCF, HGFB, HPTA, SF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028864: 93%, ENSRNOG00000007027: 92%
Entrez Gene ID: 3082
Uniprot ID: P14210
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLRVVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEA
• Gene Sequence: GPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLRVVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEA
• Gene ID - Mouse: ENSMUSG00000028864
• Gene ID - Rat: ENSRNOG00000007027
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.