Anti HFM1 pAb (ATL-HPA035036)

Atlas Antibodies

SKU: ATL-HPA035036-25

• 

Protein Description: HFM1, ATP-dependent DNA helicase homolog (S. cerevisiae)
Gene Name: HFM1
Alternative Gene Name: FLJ36760, FLJ39011, MER3, SEC63D1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043410: 79%, ENSRNOG00000023299: 69%
Entrez Gene ID: 164045
Uniprot ID: A2PYH4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSVPPVKRLKIQMNKSQSVDLKEFGFTPKPSLPSISRSEYLNISELPIMEQWDQPEIYGKVRQEPSEYQDKEVLNVNFELGNEVWDD
• Gene Sequence: SSVPPVKRLKIQMNKSQSVDLKEFGFTPKPSLPSISRSEYLNISELPIMEQWDQPEIYGKVRQEPSEYQDKEVLNVNFELGNEVWDD
• Gene ID - Mouse: ENSMUSG00000043410
• Gene ID - Rat: ENSRNOG00000023299
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.