Anti HERPUD1 pAb (ATL-HPA040754)

Atlas Antibodies

Catalog No.: ATL-HPA040754-25

Protein Description: homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1
Gene Name: HERPUD1
Alternative Gene Name: HERP, KIAA0025, Mif1, SUP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031770: 86%, ENSRNOG00000018796: 84%
Entrez Gene ID: 9709
Uniprot ID: Q15011
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RDLELSGDRGWSVGHLKAHLSRVYPERPRPEDQRLIYSGKLLLDHQCLRDLLPKQEKRHVLHLVCNVKSPSKMPEINAKVAESTEEPAGSNRGQYPEDSSSDGLRQREVLR
• Gene Sequence: RDLELSGDRGWSVGHLKAHLSRVYPERPRPEDQRLIYSGKLLLDHQCLRDLLPKQEKRHVLHLVCNVKSPSKMPEINAKVAESTEEPAGSNRGQYPEDSSSDGLRQREVLR
• Gene ID - Mouse: ENSMUSG00000031770
• Gene ID - Rat: ENSRNOG00000018796
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.