Anti HERC5 pAb (ATL-HPA043929)

Atlas Antibodies

Catalog No.: ATL-HPA043929-25

Protein Description: HECT and RLD domain containing E3 ubiquitin protein ligase 5
Gene Name: HERC5
Alternative Gene Name: CEB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029798: 44%, ENSRNOG00000023969: 43%
Entrez Gene ID: 51191
Uniprot ID: Q9UII4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SKIKLLHTDTLLKIESKKHKAYLRSAAIEEERESEFALRPTFDLTVRRNHLIEDVLNQLSQFENEDLRKELWVSFSGEIGYDLGGVKKEFFYCLFA
• Gene Sequence: SKIKLLHTDTLLKIESKKHKAYLRSAAIEEERESEFALRPTFDLTVRRNHLIEDVLNQLSQFENEDLRKELWVSFSGEIGYDLGGVKKEFFYCLFA
• Gene ID - Mouse: ENSMUSG00000029798
• Gene ID - Rat: ENSRNOG00000023969
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.