Anti HEMK1 pAb (ATL-HPA034702)

Atlas Antibodies

Catalog No.: ATL-HPA034702-25

Protein Description: HemK methyltransferase family member 1
Gene Name: HEMK1
Alternative Gene Name: MTQ1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032579: 82%, ENSRNOG00000015458: 83%
Entrez Gene ID: 51409
Uniprot ID: Q9Y5R4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VSNPPYVFHQDMEQLAPEIRSYEDPAALDGGEEGMDIITHILALAPRLLKDSGSIFLEVDPRHPELVSSWLQSRPDLYLNLVAVRRDFCG
• Gene Sequence: VSNPPYVFHQDMEQLAPEIRSYEDPAALDGGEEGMDIITHILALAPRLLKDSGSIFLEVDPRHPELVSSWLQSRPDLYLNLVAVRRDFCG
• Gene ID - Mouse: ENSMUSG00000032579
• Gene ID - Rat: ENSRNOG00000015458
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.