Anti HDHD3 pAb (ATL-HPA020427 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA020427-25

• 
• 
• 

Protein Description: haloacid dehalogenase-like hydrolase domain containing 3
Gene Name: HDHD3
Alternative Gene Name: C9orf158, MGC12904
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038422: 75%, ENSRNOG00000015195: 75%
Entrez Gene ID: 81932
Uniprot ID: Q9BSH5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLAHMEPVVAAHVGDNYLCDYQGPRAVGMHSFLVVGPQALDPVVRDSVPKEHILPSLAHLL
• Gene Sequence: RLAHMEPVVAAHVGDNYLCDYQGPRAVGMHSFLVVGPQALDPVVRDSVPKEHILPSLAHLL
• Gene ID - Mouse: ENSMUSG00000038422
• Gene ID - Rat: ENSRNOG00000015195
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.