Anti HDHD2 pAb (ATL-HPA040697)

Atlas Antibodies

SKU: ATL-HPA040697-25

• 

Protein Description: haloacid dehalogenase-like hydrolase domain containing 2
Gene Name: HDHD2
Alternative Gene Name: DKFZP564D1378
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025421: 87%, ENSRNOG00000043171: 89%
Entrez Gene ID: 84064
Uniprot ID: Q9H0R4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TVVGKPEKTFFLEALRGTGCEPEEAVMIGDDCRDDVGGAQDVGMLGILVKTGKYRASDEEKINPPPYLTCESFPHAVDH
• Gene Sequence: TVVGKPEKTFFLEALRGTGCEPEEAVMIGDDCRDDVGGAQDVGMLGILVKTGKYRASDEEKINPPPYLTCESFPHAVDH
• Gene ID - Mouse: ENSMUSG00000025421
• Gene ID - Rat: ENSRNOG00000043171
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.