Anti HDAC5 pAb (ATL-HPA030991)

Atlas Antibodies

Catalog No.: ATL-HPA030991-25

Protein Description: histone deacetylase 5
Gene Name: HDAC5
Alternative Gene Name: FLJ90614, KIAA0600, NY-CO-9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008855: 85%, ENSRNOG00000020905: 84%
Entrez Gene ID: 10014
Uniprot ID: Q9UQL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: THPEETEEELTEQQEVLLGEGALTMPREGSTESESTQEDLEEEDEEDDGEEEEDCIQVKDEEGESGAEEGPDLEEPGAGYKKLFSDAQP
• Gene Sequence: THPEETEEELTEQQEVLLGEGALTMPREGSTESESTQEDLEEEDEEDDGEEEEDCIQVKDEEGESGAEEGPDLEEPGAGYKKLFSDAQP
• Gene ID - Mouse: ENSMUSG00000008855
• Gene ID - Rat: ENSRNOG00000020905
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.