Anti-HDAC10 pAb (ATL-HPA019662)

Atlas Antibodies

Catalog No.:
ATL-HPA019662-100
Immunofluorescent staining of human cell line Hep-G2 shows localization to nucleoplasm & cytosol.
Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Polyclonal Antibody against Human HDAC10, Gene description: histone deacetylase 10, Alternative Gene Names: DKFZP761B039, Validated applications: ICC, WB, Uniprot ID: Q969S8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTTPDITLVLPPDVIQQEASALREETEAWARPHESLAREEALTALGKLLYLLDGMLDGQVNSGIAATPASAAAATLDVAVRRGLSHGAQRLLCVALGQLDRPPDLAHDGRSLWLNIRGKEAAALSMFHVS
Gene Sequence LTTPDITLVLPPDVIQQEASALREETEAWARPHESLAREEALTALGKLLYLLDGMLDGQVNSGIAATPASAAAATLDVAVRRGLSHGAQRLLCVALGQLDRPPDLAHDGRSLWLNIRGKEAAALSMFHVS
Gene ID - Mouse ENSMUSG00000062906
Gene ID - Rat ENSRNOG00000031915
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti-HDAC10 pAb (ATL-HPA019662)
Vendor Page Anti-HDAC10 pAb (ATL-HPA019662) at Atlas Antibodies

Documents & Links for Anti-HDAC10 pAb (ATL-HPA019662)
Vendor Page Anti-HDAC10 pAb (ATL-HPA019662)
!