Anti HCAR2 pAb (ATL-HPA028660)

Atlas Antibodies

Catalog No.: ATL-HPA028660-25

Protein Description: hydroxycarboxylic acid receptor 2
Gene Name: HCAR2
Alternative Gene Name: GPR109A, HCA2, HM74A, NIACR1, Puma-g, PUMAG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045502: 69%, ENSRNOG00000026653: 67%
Entrez Gene ID: 338442
Uniprot ID: Q8TDS4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPEALMANSGEPWSPSYLGP
• Gene Sequence: NRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPEALMANSGEPWSPSYLGP
• Gene ID - Mouse: ENSMUSG00000045502
• Gene ID - Rat: ENSRNOG00000026653
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.