Anti GZF1 pAb (ATL-HPA024520)

Atlas Antibodies

Catalog No.: ATL-HPA024520-25

Protein Description: GDNF-inducible zinc finger protein 1
Gene Name: GZF1
Alternative Gene Name: dJ322G13.2, ZBTB23, ZNF336
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027439: 73%, ENSRNOG00000004735: 73%
Entrez Gene ID: 64412
Uniprot ID: Q9H116
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MLEVAEKLKCLDLSETCFQLKKQMLESVLLELQNFSESQEVEVSSGSQVSAAPAPRASVATDGPHPSGLTDSLDYPGERASNGMSSDLPPKK
• Gene Sequence: MLEVAEKLKCLDLSETCFQLKKQMLESVLLELQNFSESQEVEVSSGSQVSAAPAPRASVATDGPHPSGLTDSLDYPGERASNGMSSDLPPKK
• Gene ID - Mouse: ENSMUSG00000027439
• Gene ID - Rat: ENSRNOG00000004735
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.