Anti GYG2 pAb (ATL-HPA005495)

Atlas Antibodies

Catalog No.: ATL-HPA005495-25

Protein Description: glycogenin 2
Gene Name: GYG2
Alternative Gene Name: GN-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019528: 26%, ENSRNOG00000011146: 33%
Entrez Gene ID: 8908
Uniprot ID: O15488
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PAFKQFGSSAKVVHFLGSMKPWNYKYNPQSGSVLEQGSASSSQHQAAFLHLWWTVYQNNVLPLYKSVQAGEARASPGHTLCHSDVGGPCADSASGVGEPCENSTPSAGVPCANSPLGSNQPAQGLPEPTQIVDETLSL
• Gene Sequence: PAFKQFGSSAKVVHFLGSMKPWNYKYNPQSGSVLEQGSASSSQHQAAFLHLWWTVYQNNVLPLYKSVQAGEARASPGHTLCHSDVGGPCADSASGVGEPCENSTPSAGVPCANSPLGSNQPAQGLPEPTQIVDETLSL
• Gene ID - Mouse: ENSMUSG00000019528
• Gene ID - Rat: ENSRNOG00000011146
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GYG2 pAb (ATL-HPA005495) – 1 Found

Visuttijai, Kittichate; Hedberg-Oldfors, Carola; Thomsen, Christer; Glamuzina, Emma; Kornblum, Cornelia; Tasca, Giorgio; Hernandez-Lain, Aurelio; Sandstedt, Joakim; Dellgren, Göran; Roach, Peter; Oldfors, Anders. Glycogenin is Dispensable for Glycogen Synthesis in Human Muscle, and Glycogenin Deficiency Causes Polyglucosan Storage. The Journal Of Clinical Endocrinology And Metabolism. 2020;105(2):557-66.