Anti GUCD1 pAb (ATL-HPA022786 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA022786-100

• 
• 

Protein Description: guanylyl cyclase domain containing 1
Gene Name: GUCD1
Alternative Gene Name: C22orf13, LLN4, MGC1842
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033416: 95%, ENSRNOG00000049952: 69%
Entrez Gene ID: 83606
Uniprot ID: Q96NT3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MHHFGVRHRFCTQTLGVDKGYKNQSFYRKHFDTEETRVNQLFAQAKACKVLVEKCTVSVKDIQAHLAQGHVAIVLVNSGVLHCDLCS
• Gene Sequence: MHHFGVRHRFCTQTLGVDKGYKNQSFYRKHFDTEETRVNQLFAQAKACKVLVEKCTVSVKDIQAHLAQGHVAIVLVNSGVLHCDLCS
• Gene ID - Mouse: ENSMUSG00000033416
• Gene ID - Rat: ENSRNOG00000049952
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.