Anti GUCA1C pAb (ATL-HPA041597)

Atlas Antibodies

Catalog No.: ATL-HPA041597-25

Protein Description: guanylate cyclase activator 1C
Gene Name: GUCA1C
Alternative Gene Name: GCAP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023982: 42%, ENSRNOG00000015402: 42%
Entrez Gene ID: 9626
Uniprot ID: O95843
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GNGKSIAGDQKAVPTQETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQVYNTFDTNKDGFIDFLEFIAAVNLIMQE
• Gene Sequence: GNGKSIAGDQKAVPTQETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQVYNTFDTNKDGFIDFLEFIAAVNLIMQE
• Gene ID - Mouse: ENSMUSG00000023982
• Gene ID - Rat: ENSRNOG00000015402
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GUCA1C pAb (ATL-HPA041597) – 1 Found

Morales-Cámara, Samuel; Alexandre-Moreno, Susana; Bonet-Fernández, Juan-Manuel; Atienzar-Aroca, Raquel; Aroca-Aguilar, José-Daniel; Ferre-Fernández, Jesús-José; Méndez, Carmen-Dora; Morales, Laura; Fernández-Sánchez, Laura; Cuenca, Nicolas; Coca-Prados, Miguel; Martínez-de-la-Casa, José-María; Garcia-Feijoo, Julián; Escribano, Julio. Role of GUCA1C in Primary Congenital Glaucoma and in the Retina: Functional Evaluation in Zebrafish. Genes. 2020;11(5)