Anti GTF3C5 pAb (ATL-HPA067063)

Atlas Antibodies

Catalog No.: ATL-HPA067063-25

Protein Description: general transcription factor IIIC, polypeptide 5, 63kDa
Gene Name: GTF3C5
Alternative Gene Name: TFiiiC2-63, TFIIIC63, TFIIICepsilon
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026816: 86%, ENSRNOG00000010981: 87%
Entrez Gene ID: 9328
Uniprot ID: Q9Y5Q8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HREGYNNPPISGENLIGLSRARRPHNAIFVNFEDEEVPKQPLEAAAQTWRRVCTNPVDRKVEEELRKLFDIRPIWSRNA
• Gene Sequence: HREGYNNPPISGENLIGLSRARRPHNAIFVNFEDEEVPKQPLEAAAQTWRRVCTNPVDRKVEEELRKLFDIRPIWSRNA
• Gene ID - Mouse: ENSMUSG00000026816
• Gene ID - Rat: ENSRNOG00000010981
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.