Anti GRWD1 pAb (ATL-HPA055680 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA055680-25

• 
• 

Protein Description: glutamate-rich WD repeat containing 1
Gene Name: GRWD1
Alternative Gene Name: GRWD, RRB1, WDR28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053801: 96%, ENSRNOG00000021058: 94%
Entrez Gene ID: 83743
Uniprot ID: Q9BQ67
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WSPTENTVFASCSADASIRIWDIRAAPSKACMLTTATAHDGDVNVISWSRREPFLLSGGDDGALKIWDLRQFKSGSP
• Gene Sequence: WSPTENTVFASCSADASIRIWDIRAAPSKACMLTTATAHDGDVNVISWSRREPFLLSGGDDGALKIWDLRQFKSGSP
• Gene ID - Mouse: ENSMUSG00000053801
• Gene ID - Rat: ENSRNOG00000021058
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.