Anti-GRK2 pAb (ATL-HPA060707)

Atlas Antibodies

Catalog No.:
ATL-HPA060707-100
Immunofluorescent staining of human cell line REH shows localization to cytosol.
Lane 1: Marker [kDa] 250,130,95,72,55,36,28,17,10<br/>Lane 2: RT-4<br/>Lane 3: U-251MG<br/>Lane 4: Human Plasma<br/>Lane 5: Liver<br/>Lane 6: Tonsil
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Polyclonal Antibody against Human GRK2, Gene description: G protein-coupled receptor kinase 2, Alternative Gene Names: ADRBK1, BARK1, Validated applications: ICC, WB, Uniprot ID: P25098, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL
Gene Sequence LVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL
Gene ID - Mouse ENSMUSG00000024858
Gene ID - Rat ENSRNOG00000018985
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti-GRK2 pAb (ATL-HPA060707)
Vendor Page Anti-GRK2 pAb (ATL-HPA060707) at Atlas Antibodies

Documents & Links for Anti-GRK2 pAb (ATL-HPA060707)
Vendor Page Anti-GRK2 pAb (ATL-HPA060707)
!