Anti GRIK5 pAb (ATL-HPA074001)

Atlas Antibodies

Catalog No.: ATL-HPA074001-25

Protein Description: glutamate ionotropic receptor kainate type subunit 5
Gene Name: GRIK5
Alternative Gene Name: GluK5, GRIK2, KA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003378: 99%, ENSRNOG00000020310: 99%
Entrez Gene ID: 2901
Uniprot ID: Q16478
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KVSTIIIDANASISHLILRKASELGMTSAFYKYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCEASTY
• Gene Sequence: KVSTIIIDANASISHLILRKASELGMTSAFYKYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCEASTY
• Gene ID - Mouse: ENSMUSG00000003378
• Gene ID - Rat: ENSRNOG00000020310
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.