Anti GRIK2 pAb (ATL-HPA014395)

Atlas Antibodies

SKU: ATL-HPA014395-25

• 

Protein Description: glutamate receptor, ionotropic, kainate 2
Gene Name: GRIK2
Alternative Gene Name: GluK2, GLUR6, MRT6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056073: 100%, ENSRNOG00000000368: 100%
Entrez Gene ID: 2898
Uniprot ID: Q13002
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEKRSFCSAMVEELRMSLKCQRRLKHKPQAPVIVKTEEVINMHTFNDRRLPGKE
• Gene Sequence: LEKRSFCSAMVEELRMSLKCQRRLKHKPQAPVIVKTEEVINMHTFNDRRLPGKE
• Gene ID - Mouse: ENSMUSG00000056073
• Gene ID - Rat: ENSRNOG00000000368
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.