Anti GPR180 pAb (ATL-HPA047250)

Atlas Antibodies

Catalog No.: ATL-HPA047250-25

Protein Description: G protein-coupled receptor 180
Gene Name: GPR180
Alternative Gene Name: ITR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022131: 76%, ENSRNOG00000009766: 81%
Entrez Gene ID: 160897
Uniprot ID: Q86V85
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLSKAQLTMTMNQTEHNLTVSQIPSPQTWHVFYADKYTCQDDKENSQVEDIPFEMVLLNPDAEGNPFDHFSAGES
• Gene Sequence: KLSKAQLTMTMNQTEHNLTVSQIPSPQTWHVFYADKYTCQDDKENSQVEDIPFEMVLLNPDAEGNPFDHFSAGES
• Gene ID - Mouse: ENSMUSG00000022131
• Gene ID - Rat: ENSRNOG00000009766
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.