Anti GPR107 pAb (ATL-HPA031704 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA031704-25

• 

Protein Description: G protein-coupled receptor 107
Gene Name: GPR107
Alternative Gene Name: FLJ20998, KIAA1624, LUSTR1, RP11-88G17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000194: 86%, ENSRNOG00000023589: 88%
Entrez Gene ID: 57720
Uniprot ID: Q5VW38
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KFRPASDNPYLQLSQEEEDLEMESVVTTSGVMESMKKVKKVTNGSVEPQGEWEGSV
• Gene Sequence: KFRPASDNPYLQLSQEEEDLEMESVVTTSGVMESMKKVKKVTNGSVEPQGEWEGSV
• Gene ID - Mouse: ENSMUSG00000000194
• Gene ID - Rat: ENSRNOG00000023589
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.