Anti GNL3L pAb (ATL-HPA036314 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036314-25

Protein Description: guanine nucleotide binding protein-like 3 (nucleolar)-like
Gene Name: GNL3L
Alternative Gene Name: FLJ10613
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025266: 94%, ENSRNOG00000002509: 94%
Entrez Gene ID: 54552
Uniprot ID: Q9NVN8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HFLTAVAHRLGKKKKGGLYSQEQAAKAVLADWVSGKISFYIPPPATHTLPTHLSAEIVKEMTEVFDIED
• Gene Sequence: HFLTAVAHRLGKKKKGGLYSQEQAAKAVLADWVSGKISFYIPPPATHTLPTHLSAEIVKEMTEVFDIED
• Gene ID - Mouse: ENSMUSG00000025266
• Gene ID - Rat: ENSRNOG00000002509
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GNL3L pAb (ATL-HPA036314 w/enhanced validation) – 1 Found

Fujita, Toshitsugu; Asano, Yoshinori; Ohtsuka, Junko; Takada, Yoko; Saito, Kazunobu; Ohki, Rieko; Fujii, Hodaka. Identification of telomere-associated molecules by engineered DNA-binding molecule-mediated chromatin immunoprecipitation (enChIP). Scientific Reports. 2013;3( 24201379):3171.